PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06569.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 279aa    MW: 30565.2 Da    PI: 4.6983
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06569.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.8e-151462148
                                  TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+W++eEd +l   v+++G+  +W + +++ g++R++k+c++rw++yl
  Zmw_sc06569.1.g00030.1.am.mk 14 RGPWSQEEDAILRSFVQRFGNAgNWIAMPQKAGLKRCGKSCRLRWLNYL 62
                                  89******************99*************************97 PP

2Myb_DNA-binding41.92.3e-1369111246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   g +T eEd l++ +  + G++ W+ Ia++++ gRt++++k++w++
  Zmw_sc06569.1.g00030.1.am.mk  69 GGFTDEEDNLILSLYGEIGSK-WSVIASRLP-GRTDNEVKNYWNT 111
                                   569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.908962IPR017930Myb domain
SuperFamilySSF466891.98E-2612109IPR009057Homeodomain-like
SMARTSM007171.3E-101364IPR001005SANT/Myb domain
PfamPF002496.9E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-221569IPR009057Homeodomain-like
CDDcd001676.90E-81662No hitNo description
PROSITE profilePS5129419.84163117IPR017930Myb domain
SMARTSM007172.6E-1267115IPR001005SANT/Myb domain
PfamPF002492.1E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2370116IPR009057Homeodomain-like
CDDcd001674.82E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRSPCCDKA WVKRGPWSQE EDAILRSFVQ RFGNAGNWIA MPQKAGLKRC GKSCRLRWLN  60
YLRPELRHGG FTDEEDNLIL SLYGEIGSKW SVIASRLPGR TDNEVKNYWN TKLKKRYLAA  120
AKREETPPPP PPPSPRFGDS VAAAATESEP QDDLPLPPPP TTTPSLANLD TAIADEDGDL  180
LVKSEQLYSE LMGLIAQQST STNAGTSTGE SLTACSSSGA SPVVRSTGSG SCHVWPMDLQ  240
DTALPSESIG SFFDAYSFQD LLATSYDEYA TVNQELMYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24141167107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008675095.11e-109PREDICTED: myb-related protein Zm38-like
TrEMBLA0A096SUS31e-109A0A096SUS3_MAIZE; Uncharacterized protein
STRINGGRMZM2G167829_P011e-109(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412